SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038489 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038489
Domain Number 1 Region: 61-115
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 3.06e-18
Family L23p 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038489   Gene: ENSMMUG00000031507   Transcript: ENSMMUT00000015434
Sequence length 117
Comment pep:novel chromosome:MMUL_1:1:141934715:141935170:1 gene:ENSMMUG00000031507 transcript:ENSMMUT00000015434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKAKKEAPAPPKAEEKAKALNAKKTVLKLSITTYKKEDPHVTRHPKYPRQSVPNKLDY
CAIIKFPLTTEYAMKKIEDNNTLVITVDVKANKHQIKQAVKKLCDINVAKVNTFISL
Download sequence
Identical sequences ENSMMUP00000038489 9544.ENSMMUP00000038489 ENSMMUP00000038489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]