SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038507 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000038507
Domain Number - Region: 66-108
Classification Level Classification E-value
Superfamily Kringle-like 0.0338
Family Kringle modules 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038507   Gene: ENSMMUG00000006298   Transcript: ENSMMUT00000045477
Sequence length 306
Comment pep:known_by_projection chromosome:MMUL_1:11:122201582:122255619:1 gene:ENSMMUG00000006298 transcript:ENSMMUT00000045477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATV
FIDFLINTYSSNYCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHI
RMVNQKLLGRSLQDVKGQEVPRPAMDFTDLSKLPLALHDPPPIPGQPGEMQPLREEATPR
SRDSPVWCQCGSCLPSQLPKSHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLY
QEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYS
GFKSPY
Download sequence
Identical sequences ENSMMUP00000038507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]