SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038521 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038521
Domain Number 1 Region: 43-153
Classification Level Classification E-value
Superfamily Immunoglobulin 3.71e-24
Family V set domains (antibody variable domain-like) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038521   Gene: ENSMMUG00000001216   Transcript: ENSMMUT00000045489
Sequence length 256
Comment pep:known_by_projection chromosome:MMUL_1:1:139918983:139924158:-1 gene:ENSMMUG00000001216 transcript:ENSMMUT00000045489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSF
WSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSI
VIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLL
LLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPAKDSSKRGRQTPVLYAMLDHSRSTKAA
SEKKAKGLGESRKDKK
Download sequence
Identical sequences A0A2K5M012 A0A2K6BFP4 F7DA08 G7NXB1
ENSMMUP00000001628 XP_001118030.1.72884 XP_005541239.1.63531 XP_011768481.1.29376 XP_011922894.1.92194 9544.ENSMMUP00000001628 ENSMMUP00000001628 ENSMMUP00000038521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]