SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038563 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038563
Domain Number 1 Region: 130-224
Classification Level Classification E-value
Superfamily Immunoglobulin 8.44e-19
Family I set domains 0.00000499
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-18
Family V set domains (antibody variable domain-like) 0.00000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038563   Gene: ENSMMUG00000001996   Transcript: ENSMMUT00000045529
Sequence length 324
Comment pep:known chromosome:MMUL_1:1:139613294:139632206:-1 gene:ENSMMUG00000001996 transcript:ENSMMUT00000045529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKAQADRKLLHLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
EWKFDQGDTTKLVCYNNKITASYEDRVTFLPSGITFKSVTREDTGTYTCMVSEEGGNNYG
EVKVKLIVLVPPSKPTVSIPSSATIGNRAVLTCSEKDGSPPSEYTWFKDGIVMPTNPKST
RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
AAVLVTLILLGILIFGIWFAYSRGHFDSKGNSNRPRHSWCEPGRAHRLSSALASLRCYRT
LAPDVCSFTGCLICLLHPTRPPTS
Download sequence
Identical sequences G7ME82
9544.ENSMMUP00000038563 ENSMMUP00000038563 ENSMMUP00000002679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]