SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038566 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038566
Domain Number 1 Region: 130-224
Classification Level Classification E-value
Superfamily Immunoglobulin 7.17e-19
Family I set domains 0.00000499
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily Immunoglobulin 2.78e-18
Family V set domains (antibody variable domain-like) 0.00000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038566   Gene: ENSMMUG00000001996   Transcript: ENSMMUT00000045532
Sequence length 299
Comment pep:known chromosome:MMUL_1:1:139612955:139632535:-1 gene:ENSMMUG00000001996 transcript:ENSMMUT00000045532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKAQADRKLLHLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
EWKFDQGDTTKLVCYNNKITASYEDRVTFLPSGITFKSVTREDTGTYTCMVSEEGGNNYG
EVKVKLIVLVPPSKPTVSIPSSATIGNRAVLTCSEKDGSPPSEYTWFKDGIVMPTNPKST
RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
AAVLVTLILLGILIFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
Download sequence
Identical sequences A0A2K5JX24 A0A2K5YDL4 A0A2K6LP06 A0A2K6RGV3 F6WSS8 I7GN79
ENSMMUP00000002677 ENSMMUP00000002678 ENSMMUP00000038566 NP_001253392.1.72884 NP_001270452.1.63531 XP_010365397.1.97406 XP_011812986.1.43180 XP_011812987.1.43180 XP_011831768.1.47321 XP_011831776.1.47321 XP_015307197.1.63531 XP_017716326.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]