SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038594 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038594
Domain Number 1 Region: 551-649
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-20
Family I set domains 0.0088
Further Details:      
 
Domain Number 2 Region: 176-264
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 363-455
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-18
Family I set domains 0.035
Further Details:      
 
Domain Number 4 Region: 457-555
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-17
Family I set domains 0.0084
Further Details:      
 
Domain Number 5 Region: 76-165
Classification Level Classification E-value
Superfamily Immunoglobulin 3.99e-16
Family I set domains 0.063
Further Details:      
 
Domain Number 6 Region: 277-359
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-16
Family I set domains 0.036
Further Details:      
 
Domain Number 7 Region: 16-53
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000183
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038594   Gene: ENSMMUG00000001107   Transcript: ENSMMUT00000045559
Sequence length 650
Comment pep:known_by_projection chromosome:MMUL_1:2:136310809:136314876:1 gene:ENSMMUG00000001107 transcript:ENSMMUT00000045559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVESTRLENQPCDLRMGSRIHVYPNGSLFIGSVTERDSGVYLCVARNKMGDDLILVHVSL
RLKPAKIDHKQYFRKQVLHGKDFQVDCKASGSPMPEISWSLPDGTMINNAMQADDSGHRT
RRYTLFNNGTLYFNKVGVAEEGDYTCYAQNTLGKDEMKVHLTVITAAPRIRQGNKTNKRI
KAGDTAVLDCEVIGDPKPKIFWLLPSNDMISFSIDRYTFHVNGSLTINKVKLLDSGEYVC
VARNPSGDDTKMYKLDVVSKPPLINGLYTNRTVIKATAVRHSKKHFDCRAEGTPSPEVMW
IMPDSIFLTAPYYGSRITVHKNGTLEIRNVRLSDSADFICVARNEGGESVLVVQLEVLEM
LRRPTFRNPFNEKVVAQLGKSTALNCSVDGNPPPEIIWILPNGTRFSNGPQSYQYLIASN
GSFIIYKTTREDAGKYRCAARNKVGYIEKLVILEIGQKPVILTYAPGTVKGISGESLSLH
CVSDGIPKPNIKWTMPSGYVVDRPQINRKYILHDNGTLVIKEATAYDRGNYICKAQNSVG
HTLITVPVMIVAYPPRITNRPPRSIVTRTGAAFQLHCVALGVPKPEITWEMPDHSLLSTA
SKERTRGSEQLHLQGTLVIQNPQTSDSGIYKCTAKNPLGSDYAATYIQVI
Download sequence
Identical sequences ENSMMUP00000038594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]