SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038601 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038601
Domain Number 1 Region: 31-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000326
Family V set domains (antibody variable domain-like) 0.05
Further Details:      
 
Domain Number 2 Region: 306-412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000171
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038601
Domain Number - Region: 169-286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000109
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038601   Gene: ENSMMUG00000031542   Transcript: ENSMMUT00000045566
Sequence length 531
Comment pep:known_by_projection chromosome:MMUL_1:1:138714203:138721517:-1 gene:ENSMMUG00000031542 transcript:ENSMMUT00000045566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALRPTLLPPSPPLLLLLLMLGMGCWAREVLVPEGPLYRVTGTAVSISCNVTGYEGPAQ
QNFEWFLYRPEAPDTALGIVSTKDTQFSYAIFKSRVVAGEVQVQRLQGDAVVLKIARLQA
QDAGIYECHTPSTDTRYLGSYSGKVELRVLPDALQVSAAPPGPRGRQAPTSPPRLMVHEG
QELALGCLARTSTQQHTHLAVSFGRSVPEAPVGRATLQEVVGIRSDLAVEAGAPYAERLA
AGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQ
TLCNQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPAGAPGPGRLV
AQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRL
REAASARSRPLPVHVREEGVVLEAVAWLAGGTVYRGETASLLCNISVRGGPPGLRLAASC
ARSGPVTVYPYMHALDTLLVPLLVGTGVALVTGATVLGTITCCFMKRLRKR
Download sequence
Identical sequences ENSMMUP00000038601 9544.ENSMMUP00000038601 ENSMMUP00000038600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]