SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038620 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038620
Domain Number 1 Region: 2-472
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-168
Family ALDH-like 0.0000000000000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038620   Gene: ENSMMUG00000008336   Transcript: ENSMMUT00000045583
Sequence length 474
Comment pep:known chromosome:MMUL_1:11:112722963:112740232:1 gene:ENSMMUG00000008336 transcript:ENSMMUT00000045583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHNAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDA
SHRGRLLNRLADLIERDRTYLAALETLDNGKPYVTSYLVDLDMVLKCLRYYAGWADKYHG
KTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTA
LYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTETGRLIQVAAGSSN
LKRVTLELGGKSPNIIMSDADNRPSSPSVCIWQSAGIILDSGGSRTFVQEDIYDEFVERS
VARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQ
PTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYL
SQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVSVGPA
Download sequence
Identical sequences ENSMMUP00000038620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]