SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038622 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038622
Domain Number 1 Region: 5-478
Classification Level Classification E-value
Superfamily ALDH-like 1.15e-170
Family ALDH-like 0.000000000000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038622   Gene: ENSMMUG00000008336   Transcript: ENSMMUT00000045585
Sequence length 479
Comment pep:known chromosome:MMUL_1:11:112722939:112740223:1 gene:ENSMMUG00000008336 transcript:ENSMMUT00000045585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLSFSLQIFINNEWHNAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLG
SPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVTSYLVDLDMVLKCLRYYA
GWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKV
AEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTETGRLI
QVAAGSSNLKRVTLELGGKSPNIIMSDADSEFPAGGGLALNATLAACVCAGSRTFVQEDI
YDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIA
ADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTK
DLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVSV
Download sequence
Identical sequences 9544.ENSMMUP00000038622 ENSMMUP00000038621 ENSMMUP00000038622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]