SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038667 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038667
Domain Number 1 Region: 235-406,450-611
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.42e-76
Family YicI catalytic domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 9-231
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.44e-44
Family YicI N-terminal domain-like 0.009
Further Details:      
 
Domain Number 3 Region: 614-710
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000619
Family Putative glucosidase YicI, domain 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038667   Gene: ENSMMUG00000001302   Transcript: ENSMMUT00000045628
Sequence length 756
Comment pep:known_by_projection chromosome:MMUL_1:2:122358741:122395014:1 gene:ENSMMUG00000001302 transcript:ENSMMUT00000045628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PECYFPRQNNSYSVTSTNYSSMGVTADLQLNTANARIKLPSDPISTLRVEVKYHKNDMLQ
FKIYDPQNKRYEVPVPLNIPNAPISTYENRLYDVEIKENPFGIQIRRRSSGRVIWDSSLP
GFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWHTWGMFTRDQPPGYKLNSYGFHP
YYMALEEEGNAHSVLLLNSNAMDVTFQPTPALTYRTVGGILDFYMFLGPTPEVSTKQYHE
VIGHPVMPPYWALGFQLCRYGYANTSEIRELYDAMVAANIPYDVQYTDIDYMERQLDFTI
GEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETRTYPAFERGQQNDVFVKWPNTNDICW
AKASRAHVAFPDFFRTSTAEWWAREIVDFYNEKMKFDGLWIDMNEPSSFVNGTTINQCRN
DKLNYPPYFPGTILLLQFQTITMCMETEQILSDGTSVLHYDVHNLYGWSQMKPTYDALQR
TTGKRGIVISRSTYPTGGRWGGHWLGDNYARWDNMDKSIIGMMEFSLFGISYTGADICGF
FNNSDYHLCTRWMQLGAFYPYSRNHNIANTRRQDPASWNETFAEMSKNILNIRYTLLPYF
YTQMHEIHAHGGTVIRPLLHEFFDEKPTWDIFKQFLWGPAFMVTPVLEPYVQIVNAYVPN
ARWFDYHTVPAFSLMNVYPQPFHFQGEDIGVRGQFYTFNASFETINLHVRGGHILPCQEP
AQNTFYSRQKYMKLIVAADDNQTAQGSLFWDDGESI
Download sequence
Identical sequences ENSMMUP00000038667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]