SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038781 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038781
Domain Number 1 Region: 17-80
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038781
Domain Number - Region: 74-133
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0577
Family Rhodopsin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038781   Gene: ENSMMUG00000013691   Transcript: ENSMMUT00000045736
Sequence length 242
Comment pep:known_by_projection chromosome:MMUL_1:15:104831433:104847275:1 gene:ENSMMUG00000013691 transcript:ENSMMUT00000045736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYIGLVMEWEIPEIICTCAQLRLPPQATFQVLRGDGASVGTVLMFHCPSNHQMVGSGLL
TCTWKGSIAEWSSGSPVCKLVPPHETFGFRVAVIASIVSCAIILLMSMAFLTCCLLKCMK
KSERRRSDRSAQLWSQLRDEDLETVQAAYLGLKHFNKPVSRSSQAHDNHSFTTDHRSVDL
EHSAQLRGDSEKPVLLRTLSLSGSSSSPQAQVMVHMANPRQPLPASGLATGMPQKPAAYA
LG
Download sequence
Identical sequences ENSMMUP00000018006 9544.ENSMMUP00000038781 ENSMMUP00000038781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]