SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038825 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038825
Domain Number 1 Region: 443-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8e-72
Family Protein kinases, catalytic subunit 0.000000484
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 68-156
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038825
Domain Number - Region: 174-261
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038825   Gene: ENSMMUG00000020009   Transcript: ENSMMUT00000045779
Sequence length 942
Comment pep:known_by_projection chromosome:MMUL_1:15:103545231:103763571:-1 gene:ENSMMUG00000020009 transcript:ENSMMUT00000045779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVPDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNIVCLL
GVVTKDQPLSMIFSYCSHSDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYMGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDAQNA
PEDGAQSPVQEAEEEEGSVPETELLGDSDTLQVDEAQVQLEA
Download sequence
Identical sequences A0A2K5UT30 F6U1X2
XP_005582291.1.63531 ENSMMUP00000038825 9544.ENSMMUP00000038825 ENSMMUP00000038823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]