SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038913 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038913
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 8.24e-171
Family Sema domain 0.0000000000000127
Further Details:      
 
Domain Number 2 Region: 502-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000144
Family Plexin repeat 0.000043
Further Details:      
 
Domain Number 3 Region: 563-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000452
Family I set domains 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038913   Gene: ENSMMUG00000008629   Transcript: ENSMMUT00000045874
Sequence length 862
Comment pep:known_by_projection chromosome:MMUL_1:15:97885024:97962842:-1 gene:ENSMMUG00000008629 transcript:ENSMMUT00000045874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCIPIRGLLMALAVMFGTAMAFAPIPRITWEHREVRLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSSLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSATVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGRRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALYQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPLTPAVQATSSGAITLPPKPVPTSTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences F7FCM4
ENSMMUP00000011320 ENSMMUP00000038913 XP_014973548.1.72884 XP_014973549.1.72884 XP_014973550.1.72884 XP_014973551.1.72884 XP_014973552.1.72884 9544.ENSMMUP00000038913 ENSMMUP00000011320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]