SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038965 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038965
Domain Number 1 Region: 1046-1194,1227-1307
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 569-808
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-26
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 3 Region: 129-274,330-400
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-18
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Domain Number 4 Region: 1356-1433
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000022
Family Voltage-gated potassium channels 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038965   Gene: ENSMMUG00000019962   Transcript: ENSMMUT00000045924
Sequence length 1435
Comment pep:known_by_projection chromosome:MMUL_1:2:97576001:97679909:1 gene:ENSMMUG00000019962 transcript:ENSMMUT00000045924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKDKSKDKTGEVPHLRPQLDLKASR
KLPNLYGDIPRELIGKPLEDLDPFYRNHKTFMVLNKKRTIYRFSAKRALFIFGPFNSIRS
LAIRVSGRFTFLMFIIGTVIINCVFMARGPAKNSNSNDTDIAECVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGIAIVSCIPGITIKLLSLRTFRVFRALKAISVVSRKS
LSLSTLAPSRKNVNLYLNFFKMSSCLGPQFLSGHTPFNHFRRCRNIHFQAHCFEKKENST
EFKMCGIWMVKSSCSKQYECNHTKSNPDYNYTNFDNFGWSFLAMFRLMTQDSWEKLYQQT
LRTAGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAEIEAKEKMFQEAQQLL
KEEKEALVAMGIDRSSLTSLETSYFTPQKRKLFGNKKRKSFFLRESGKGQPPGSDSDEDS
QKKPQLLEQTKRLSQNLSLDHFDEHRDPLQRQRALSAVSILTITMKEQEKSQEPCLPCGE
NLASKYLVWNCCPLWLCIKKVLRTVMTDPFTELAITICIIINTVFLAMEHHKMEASFEKM
LNTGNLVFTSIFIAEMCLKIIALDPYHYFRRGWNIFDSIVALLSFADVMNIFQKRSWPFL
RSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLVIVIFIFSVVGMQLFGHSFNS
QKSAKLCNPTGPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEANASSSLCVI
VFILITVIGKLVVLNLFIALLLNSFSNEERNGNLEGQARKTKVQLALDRFRRAFCFVRHT
LEHFCHKWCRKQKLPKQKEVTGGCAAQSKDIIPLVTEMKRGSETQEELGILTSVPKTLGI
RHDRTWLAPLAEEEDDAEFSGEDNAQPITQPEAEQQAYELHQENKKPTSQGVQNVEIDMF
PEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGLLPEMVPEKQPERCLPKGFGCCFPC
CSMDKRKPHWVIWWNLRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVYLKDRPKIQEL
LNCTDIIFTYVFILEMVLKWVAFGFGKYFTSAWCCLDFIIVIVSVTTLINLKELKSFRTL
RALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLIFCILGVHFFSGKFGKCIN
GTESVISYTIIANKSQCESGNFSWINQKVNFDNVGNAYLALLQVATFKGWMDIIYAAVDS
REKEQQPKFESNSLGYIYFVVFIVFGSFFTLNLFIGVIIDNFNQQQKKISGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPLNKCQGLVFDVVTSQIFDIIIISLIILNMISMMAESYD
QSKAVKSTLDHLNWVFVVIFTLECLIKIFALRQYYFTNGWNLFDSVVVLISIVSK
Download sequence
Identical sequences ENSMMUP00000038965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]