SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039091 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039091
Domain Number 1 Region: 25-157
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-33
Family C-type lectin domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 5-32
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000051
Family Triple coiled coil domain of C-type lectins 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039091   Gene: ENSMMUG00000019129   Transcript: ENSMMUT00000046050
Sequence length 160
Comment pep:known chromosome:MMUL_1:2:91495802:91501593:-1 gene:ENSMMUG00000019129 transcript:ENSMMUT00000046050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQAKTFHEASEDCISRG
GTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMATEGIWVDMTGARIAYKNWETEIT
AQPDGGKTENCAVLSGAANGKWFDKRCRDPLPYICQFGIV
Download sequence
Identical sequences ENSMMUP00000039091 XP_014986643.1.72884 XP_015301249.1.63531 XP_017731753.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]