SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039147 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039147
Domain Number 1 Region: 225-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-56
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,88-160
Classification Level Classification E-value
Superfamily POZ domain 9.07e-29
Family Tetramerization domain of potassium channels 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039147   Gene: ENSMMUG00000012362   Transcript: ENSMMUT00000046103
Sequence length 558
Comment pep:known chromosome:MMUL_1:11:72049113:72238820:-1 gene:ENSMMUG00000012362 transcript:ENSMMUT00000046103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSDN
CKEVVITGYTQAEARSLT
Download sequence
Identical sequences A0A2I2ZS76 A0A2I3M2X2 A0A2J8W1F1 A0A2K5I678 A0A2K5MAL7 A0A2K5V4V6 A0A2K5XBW0 A0A2K6CMW1 A0A2K6NXC4 F7BL65
ENSMMUP00000039147 gi|24497458|ref|NP_715624.1| NP_715624.1.87134 NP_715624.1.92137 XP_002798727.1.72884 XP_005571628.1.63531 XP_008956623.1.60992 XP_008956624.1.60992 XP_009246317.1.23681 XP_010360961.1.97406 XP_011725446.1.29376 XP_011784744.1.43180 XP_011850708.1.47321 XP_011905141.1.92194 XP_018894972.1.27298 XP_018894973.1.27298 ENSP00000319877 ENSP00000319877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]