SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039153 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039153
Domain Number 1 Region: 36-105
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000733
Family Ribosomal protein L11, C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039153
Domain Number - Region: 1-45
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00017
Family Ribosomal L11/L12e N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039153   Gene: ENSMMUG00000019259   Transcript: ENSMMUT00000027049
Sequence length 122
Comment pep:novel chromosome:MMUL_1:15:76719211:76719576:-1 gene:ENSMMUG00000019259 transcript:ENSMMUT00000027049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGDDIPKATGHQKSQRITMKLTNQNRQAQTEVVLSASAMSIKALKEPETERGKKIKHSGN
AIFHETVNIARQMQHQSLVTELSGTRKEILETAQSMSCSVDGHQPPDIIDDITSTVLQVN
IQ
Download sequence
Identical sequences F7BKW0 G7PSG8
9544.ENSMMUP00000039153 ENSMMUP00000039153 ENSMMUP00000039153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]