SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039167 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039167
Domain Number 1 Region: 65-258
Classification Level Classification E-value
Superfamily Formyltransferase 1.57e-58
Family Formyltransferase 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039167
Domain Number - Region: 1-58
Classification Level Classification E-value
Superfamily ACT-like 0.00298
Family BT0572-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039167   Gene: ENSMMUG00000031738   Transcript: ENSMMUT00000046124
Sequence length 259
Comment pep:novel scaffold:MMUL_1:1099214264691:3:782:1 gene:ENSMMUG00000031738 transcript:ENSMMUT00000046124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPDGFDEQAFRDGLATRGEAFGMIFELTAP
NYRPKVVIMVSKADHCLNDLLYRQRIGQLSMDVVAVVSNHPDLKPLADWHQIPYYHFPLD
PNDKPSQERQVWQVIEESGAELVILARYMQVLSPELCRKLDGKAINIHHSLLPGFKGAKP
YHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIEGLTLARA
VGYHIERRVFLNANRTVVL
Download sequence
Identical sequences 9544.ENSMMUP00000039167 ENSMMUP00000039167 ENSMMUP00000039167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]