SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039249 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039249
Domain Number 1 Region: 2009-2178
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1738-1850
Classification Level Classification E-value
Superfamily CalX-like 1.31e-19
Family CalX-beta domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039249
Domain Number - Region: 388-425
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0112
Family Purple acid phosphatase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039249   Gene: ENSMMUG00000008128   Transcript: ENSMMUT00000046207
Sequence length 2179
Comment pep:known_by_projection chromosome:MMUL_1:15:62045862:62176592:1 gene:ENSMMUG00000008128 transcript:ENSMMUT00000046207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLSWGAVNALLLLLLLAWASPTFISVNRGVRVMKGHSTFLSGDDLKFAIPKEKDACKV
EVVMNEPITQRVGKLTPQVFDCHFLTNEVKYVHNGCPILDEDTVKLRLYRFTETDTFIET
FILRVYLLEPDCNIIRMSNNVLEVPEFNGLSQAIDKNLLRFDYDRMASLECTVSLDTART
QLPAHGQMVLGEPRPEPRGDQPHSFFPAPLGAKLKCPGGSCTPGLKKIGSLKVSCEEFLL
MGLRYQHLDPPSPNIDYISIQLDLTDTRSKIVYKSESAWLPVYIRAGIPNQIPKAAFMAM
FILEVDQFILTSLTTSVLDCEEDETAKHLLVFNITKAPLQGYVTHLLDHTRPISSFTWKD
LSDMQIAYQPPNCSHSERRHDEVELEVYDFFFERSAPMTVHISIRTADTNAPRVSWNTGL
NLLEGQSRAITWEQFQVVDNDDIGAVRLVTVGGLQHGWLTLRGGKGFLFTVADLQAGVVR
YHHDDSDSTKDFVVFRIFDGHHSIRHKFPINILPKDDSPPFLITNVVIELEEGQTILIQG
SMLRASDVDASDDYIFFNITKPPQAGEIMKKPGPGLIGYPVPGFLQRDLFNGIIYYRHFG
GEIFEDSFQFVLWDSHEPPNLSVPQVATIHITPVDDQLPKEAPGVSRHLVVKETEVAYIT
KKQLHFIDTESYDRELVYTITTPPFFSFSHRHLDAGKLFLVDSIPKVVKNPTALELRSFT
QHAVNYMKVAYMPPMQDIGPHCRDVQFIFSVSKQHGGTLHGICFNITVLPVDNQVPEVFT
NPLKVTEGGQCVISTEHILISDADTKLDNIDLSLRGLPLHGRVELNGFPLNSGGTFSWAD
LHTLKVRYQHDGSEVLQDDILLEVTDGTNSAEFVLHVKVFPVNDEPPVLKADLTPVMNCS
EGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRKAGVTVDQFSQGDVISEAVTYK
HTGGEIGMMPCSDTITLVVSDGDAGPFVNGCCYNGPNPSVPLHTSFPVYDLNITVYPVDN
QPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTASDDLEFVLVSPPQFGYLENILPSVGF
EKSNIGISIDSFQWKDMNAFHINYVQSRHLRIEPTADQFTVYATDGKQRSLEIPFSIIIN
PTNDEAPDFVVQNITVCEGQMKELDSSVISAVDLDIPQDPLLFSITQKPRHGLLINRGFS
KDFPENEQPANPERKHEPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKILK
TISVEVTPVNDEKPMLSKKAEIAMNMGGTRIISSAILSAIDEDSPREKIYYVFERLPQNG
QLQFKIGRDWVPLSPGMKCTQEEVDLNLLRYTHTGAMDSQNRDSFTFYLWDGDNRSPALD
CQITINDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPQYGQV
EYVHYPGVPITSFSQMDVAGQTVCYVHKSKVTVSSDRFRFIISNGLRTKHGVFEITLETV
DRALPVVTRNKGLRLAQGAVGLLSPDLLQLTDPDTAAENLTFLLVQLPQHGQLYLWGTGL
LQHNFTQQDVDSRNVAYRHSGGDSQTDCFTFMATDRTNQGFVVNGRMWEEPVLFTIQVDQ
LDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLE
NTTTGEFIHEKFSQKDLNSKTILYIINPSLEVNSDTMEFQIMDPTGNSATPQILELKWSH
IEWSQTEYEVCENVGVLPLEIIRRGYSMDSAFVGIKVNQVSAAVGKDFTVTPSKLIQFDP
GMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSYSSN
QSKHSTWEKGIWRLLPPGSSSSTTSGSFHLERRPLPSSTQLAVTRGDTLRGFESTDLSQR
KLRTRGNSKTVRPFSVYRNGTDIIYNYHGIVSLKLEDDSFPTHKRKAKVSILSQPQKTIK
VAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWKAWS
PQTKDVEDKSCPAGWHQHSGYCHILITEQESTWNAAARACREQYMGNLVTVFSRQHMRWL
WDIGGRKSFWIGNGLNDQVRAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKW
QAKDCRRAKPYNYVCSRKL
Download sequence
Identical sequences ENSMMUP00000015942 ENSMMUP00000039249 9544.ENSMMUP00000039249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]