SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039315 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039315
Domain Number 1 Region: 293-393
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000125
Family B-box zinc-binding domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039315
Domain Number - Region: 121-224
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00392
Family Apolipoprotein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039315   Gene: ENSMMUG00000015976   Transcript: ENSMMUT00000046272
Sequence length 476
Comment pep:known chromosome:MMUL_1:1:120085071:120094642:-1 gene:ENSMMUG00000015976 transcript:ENSMMUT00000046272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGVKALTIDHLAVNDVMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRR
QKKTTYHTMVDLKDLKGYSRIGKPILCPIHPAEELRLFCEFCDRPVCRDCVVGEHREHPC
DFTSNVIHKHGDSVRELLKGTQPHVEALEEALAQINIMNSALQKRVEAVAADVQTFSEGY
IKAIEEHRDKLLKQLEDIRIQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEIL
ITKGVVVERLRKLNKVQYSARPGVNDKIRFCPQEKAGQCHGYEIYGTINTKEVDPAKCVL
QGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNIQVAVLPKDKKDSPVRPMVQDNKDGT
YYISYTPKEPGVYTVWVCVKEQHVQGSPFTVTVRRKHRPHPGVFHCCTFCSSGGQKTARC
ACGGTMPGGYLGCGHGHKGHPGRPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences F6XP18
ENSMMUP00000039315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]