SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039338 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039338
Domain Number 1 Region: 43-653
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.58e-230
Family Aconitase iron-sulfur domain 9.59e-17
Further Details:      
 
Domain Number 2 Region: 658-911
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.14e-83
Family LeuD-like 0.000000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039338   Gene: ENSMMUG00000008196   Transcript: ENSMMUT00000046296
Sequence length 913
Comment pep:known chromosome:MMUL_1:15:44774583:44843244:-1 gene:ENSMMUG00000008196 transcript:ENSMMUT00000046296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPQPLSKSNFHHPAVWNTWPSVIMSNPFAHLAEPLDPVQPGKKFFNLNKLEDPRYGRLP
FSIRILLEAAIRNCDEFLVKKHDIENILHWNVMQHENIEVPFKPARVILQDFTGVPAVVD
FAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEF
LKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGI
LGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGK
FVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKVKYIKKY
LQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAK
QGFKGFQVAPEHHNDHKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKA
VDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEP
VVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLG
VNAKGQKVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFW
NSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYL
TNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAA
ERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPL
EYLPGENADALGLTGQERYTIIIPENLKPRMKVQVKLDTGKTFQVVMRFDTDVELTYFLN
GGILNYMIRKMAK
Download sequence
Identical sequences ENSMMUP00000039338 9544.ENSMMUP00000039338 ENSMMUP00000010735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]