SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039462 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039462
Domain Number 1 Region: 212-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-57
Family Voltage-gated potassium channels 0.00044
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 8.37e-25
Family Tetramerization domain of potassium channels 0.00000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039462   Gene: ENSMMUG00000016056   Transcript: ENSMMUT00000022581
Sequence length 511
Comment pep:known_by_projection chromosome:MMUL_1:1:113575680:113577215:-1 gene:ENSMMUG00000016056 transcript:ENSMMUT00000022581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNWKILISDSTNHE
TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARSVAVVSVLVVVISITIFCLETLPE
FREDRELKVVREPNLNMSKTVLSQTMFTDPFFMVESTCIMWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFATVITELAQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPSEI
ERILNGVGSRMGSTDSLSKTNGGCSTEKSRK
Download sequence
Identical sequences F7HL26
ENSMMUP00000039462 XP_001101275.1.72884 ENSMMUP00000039462 9544.ENSMMUP00000039462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]