SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039529 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039529
Domain Number 1 Region: 36-166
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.14e-32
Family MaoC-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039529   Gene: ENSMMUG00000002841   Transcript: ENSMMUT00000046492
Sequence length 168
Comment pep:known chromosome:MMUL_1:2:78067799:78079182:-1 gene:ENSMMUG00000002841 transcript:ENSMMUT00000046492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLISSHRFWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELT
GDVNPLHLNEDFAKHTKFGNTIVHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYI
GEVVLASAEVKKLKRFIAIIAVSCSVIESKKTVMEGWVKVMVPEAPKS
Download sequence
Identical sequences A0A0D9SBS9 F7H2H7 G7NZB8
ENSMMUP00000003802 9544.ENSMMUP00000039529 XP_007982967.1.81039 XP_014986077.1.72884 XP_014986078.1.72884 XP_015300794.1.63531 XP_015300795.1.63531 XP_015300796.1.63531 XP_015300797.1.63531 XP_015300798.1.63531 ENSMMUP00000003802 ENSMMUP00000039529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]