SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039571 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039571
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 364-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039571
Domain Number - Region: 424-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00093
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0314
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039571   Gene: ENSMMUG00000008197   Transcript: ENSMMUT00000046538
Sequence length 494
Comment pep:known chromosome:MMUL_1:1:110050940:110394263:1 gene:ENSMMUG00000008197 transcript:ENSMMUT00000046538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCDFMVSG
LTYCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIAN
VCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALL
LLTTLLGTASPLVF
Download sequence
Identical sequences ENSMMUP00000039571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]