SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039591 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039591
Domain Number 1 Region: 42-430
Classification Level Classification E-value
Superfamily L domain-like 9.86e-58
Family Ngr ectodomain-like 0.072
Further Details:      
 
Domain Number 2 Region: 601-686
Classification Level Classification E-value
Superfamily Immunoglobulin 2.28e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 445-555
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily L domain-like 0.0000000102
Family Ngr ectodomain-like 0.056
Further Details:      
 
Domain Number 5 Region: 543-588
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000443
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039591   Gene: ENSMMUG00000001531   Transcript: ENSMMUT00000046559
Sequence length 992
Comment pep:known_by_projection chromosome:MMUL_1:2:69710846:69797821:1 gene:ENSMMUG00000001531 transcript:ENSMMUT00000046559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAIPSLGAASSHVVSLFLQHNKIRSVEGS
QLKAYLSLEVLDLSSNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTL
RLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDG
AFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHRKGWSFCQKLHELV
LSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVLDLDHNEIAGTIED
TSGAFSGLDSLSKLLLLEPSQSAGCSSPSQPHMSAGGRTLFGNKIKSVAKRAFSGLEGLE
HLNLGGNAIRSVQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLMGRMLQAFVTATCA
HPESLKGQSIFSVPPESFVCDDFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFA
WKKDNEVLTNADMENFVHVHAQDGEVMEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSH
KARLTVNVLPSFTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAAQTPSLA
VPLEDRVVSAGETVALQCKATGNPPPRITWFKGDGPLSLTERHHLTPDNQLLVVQNVVAE
DAGRYTCEMSNTLGTERAHSQLSVLPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIY
QTRKKSEEYSVTNTDETIVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCP
RDASHFPEADAHSVACRQPKLCTGYHKEPWKATEKAEGTPGLQKMEHGGRVVCSDCNTEV
DCYSREQDFHPQPVSRDSVQPNGPEPGGSDQEHSPHHQCSGTAAGSCPECQGSLYPSNHD
RMLTAVKKKPMASLDGKGDSSWTLARLYDPDCAELQPASSLTSGSPERTAAQHLLVSNGH
LPRACDSSPESMPLTGQLPGKQRVPLLLAPKS
Download sequence
Identical sequences ENSMMUP00000039591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]