SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039729 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039729
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.12e-22
Family DNA repair glycosylase, 2 C-terminal domains 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039729   Gene: ENSMMUG00000006117   Transcript: ENSMMUT00000046699
Sequence length 126
Comment pep:known chromosome:MMUL_1:2:51230595:51246286:-1 gene:ENSMMUG00000006117 transcript:ENSMMUT00000046699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILE
EQGGLPWLQQLREASYEEAHKALCTLPGVGTKGLLGNAFDGHQLLRPFIFCQDHLREGPP
MGRGDS
Download sequence
Identical sequences ENSMMUP00000039729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]