SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039732 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039732
Domain Number 1 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.3e-39
Family DNA repair glycosylase, N-terminal domain 0.000000235
Further Details:      
 
Domain Number 2 Region: 136-193
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0000000000137
Family DNA repair glycosylase, 2 C-terminal domains 0.0000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039732   Gene: ENSMMUG00000006117   Transcript: ENSMMUT00000046702
Sequence length 195
Comment pep:known chromosome:MMUL_1:2:51230203:51247390:-1 gene:ENSMMUG00000006117 transcript:ENSMMUT00000046702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASAPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQPGRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPSWQCI
Download sequence
Identical sequences A0A2K5X0Y7 F7GWH5
ENSMMUP00000039732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]