SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039733 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039733
Domain Number 1 Region: 136-318
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.97e-49
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000284
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.41e-38
Family DNA repair glycosylase, N-terminal domain 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039733   Gene: ENSMMUG00000006117   Transcript: ENSMMUT00000046703
Sequence length 350
Comment pep:known chromosome:MMUL_1:2:51230145:51247390:-1 gene:ENSMMUG00000006117 transcript:ENSMMUT00000046703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASAPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQPGRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLPWLQQLREASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDVHIWQIAQRDYSWHPTTSQAKGPSPQSNKELG
NFFRSLWGPHAGWAQAGLLGNAFDGHQLLRPFIFCQDHLREGPPMGRGDS
Download sequence
Identical sequences ENSMMUP00000039733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]