SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039814 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039814
Domain Number 1 Region: 416-903
Classification Level Classification E-value
Superfamily ALDH-like 8.77e-165
Family ALDH-like 0.000000000741
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 6.02e-51
Family Formyltransferase 0.00000000272
Further Details:      
 
Domain Number 3 Region: 205-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.3e-23
Family Post formyltransferase domain 0.0000013
Further Details:      
 
Domain Number 4 Region: 327-405
Classification Level Classification E-value
Superfamily ACP-like 0.0000101
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039814   Gene: ENSMMUG00000012488   Transcript: ENSMMUT00000046786
Sequence length 904
Comment pep:known chromosome:MMUL_1:2:45883061:45964660:-1 gene:ENSMMUG00000012488 transcript:ENSMMUT00000046786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYGHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFSRWR
AKGQALPEVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKIDWDQPAEAIHNWIRGNDKVPGAWTEACEP
LQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGK
MILASNFFKGAASSALELTEAELVTAEAVRSAWQRILPNVLEVEDSTDFFKSGAASVDVV
RLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTL
HMPHQLFIGGAFVDAEGAKTFETINPTDGSVICQVSLAQVTDVDKAVATAKDAFENGRWG
KISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCD
KIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKP
AQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLIGQRLSDHPDVRKIGFTGSTEVGKHI
MKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDS
IHDEFVRRVVQEVRKMKVGNPLDRDTDHGPQNHHAHLMKLMEYCQCGVKEGATLVCGGNQ
IPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDVDAVLSRANATEFGLASGV
FTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTV
TFEY
Download sequence
Identical sequences A0A1D5QNH6 A0A2K6D0A5 G7NYF0
NP_001252951.1.72884 XP_005547969.1.63531 XP_011720336.1.29376 9544.ENSMMUP00000016399 ENSMMUP00000016401 ENSMMUP00000016399 ENSMMUP00000039814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]