SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039846 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039846
Domain Number 1 Region: 59-300
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.65e-58
Family Decarboxylase 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039846   Gene: ENSMMUG00000032009   Transcript: ENSMMUT00000046816
Sequence length 302
Comment pep:known chromosome:MMUL_1:2:44733864:44748563:1 gene:ENSMMUG00000032009 transcript:ENSMMUT00000046816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEILEQQKKIDAETVGRVKRFIQENVFVAANHNGSALSIKEAPRELSFGARAELPRIHP
VASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKEL
ITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVG
LPLHRGCLLIAEMSSSGSLATGNYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPG
VQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
GV
Download sequence
Identical sequences ENSMMUP00000039846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]