SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039864 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039864
Domain Number 1 Region: 82-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.15e-17
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 2 Region: 289-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-16
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 3 Region: 498-697
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-16
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 4 Region: 26-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000081
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 5 Region: 727-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000528
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 6 Region: 843-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000727
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 762-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000444
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039864
Domain Number - Region: 805-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0115
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 515-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0967
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039864   Gene: ENSMMUG00000006345   Transcript: ENSMMUT00000046834
Sequence length 953
Comment pep:known_by_projection chromosome:MMUL_1:15:12355214:12366747:-1 gene:ENSMMUG00000006345 transcript:ENSMMUT00000046834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMEPGALWTFLGHLWLLTGPTCEEDVDECLSDPCLHGGNCSDTVAGYICRCPETWGGRD
CSVQLTGCQGHTCPLAATCIPIFESGVHSYVCHCPPGTHGPFCGQNTTFSVMAGRPIQAS
VPAGGPLGLALRFRTTLPAGTLATRNDTRESLELALVAATLQATLWSHGTTVLVLRLPDL
GLNDGHWHQVEVVLHLATLELRLWHEGCPARLCVASGPVALAPTASATPLPAGISSAQLG
DATFAGCLQDVRVDGHLLLPEDLGENVLLGCERREQCQPLPCVHGGSCVDLWTHFRCNCP
RPHRGPTCADEIPAATFGLGGAPSSVSFLLQELPGPNLTLSFLLRTRESAGLLLQFANDS
AAGLTVFLSEGRIRAEAPGGPAVVLPGRWDDGLRHLVTLSFGPEQLQDLGQHMHVGGRLL
AADSQPWGGPFRGCLQDLRLDGRHLPFFPLPLDNSSQPSELGGRQSWNLTAGCVSEDMCS
PDPCFNGGTCLVTWNDFHCTCPANFTGPTCAQQLWCPGQPCLPPATCEEVPDGFVCVAEA
TFHEGPPVAFSGHNASSGRSLGSLSLAFRTRDSEAWLLRATAGALAGVWLAVRNGSLAGG
VRGGHGLSGALLPIPGPRVADGAWHRVRLAMERPAAAPSRWLLWLDGAATPVALRGLAGD
LGFLQGPGAAHILLAENFTGCLGRVALGGLPLPLARPRPGVAPGAQEHFAAWPGTPAPIL
GCRGAPVCAPSPCLHGGDCRDLFDAFACACGPGWEGPRCEAHVNPCDSAPCARGRCHTHP
DGRFECHCPPGFGGPRCRLPVPSKECILNVTCLDGSPCEGGSPAVNCSCLEGLAGQRCQV
PALPCETNPCLNGGTCRAAGGVSECICNARFSGQFCEVVKGVPLPLPFPLLEVAVPAACA
CLLLLLLGLLSGILAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences ENSMMUP00000039864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]