SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039972 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039972
Domain Number 1 Region: 28-116
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.31e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000817
Further Details:      
 
Domain Number 2 Region: 105-178
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.27e-18
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039972   Gene: ENSMMUG00000032031   Transcript: ENSMMUT00000046940
Sequence length 195
Comment pep:novel chromosome:MMUL_1:2:38354097:38354684:1 gene:ENSMMUG00000032031 transcript:ENSMMUT00000046940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRRSARRGQRCNLLRSSRIRVHPTPAASTMPRKFDPKEIKVVYLRCTGGEVGATSALAP
KIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPR
DRKKQKNIKHSGNITCDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGHHPHD
LIDDINSGAVECPAS
Download sequence
Identical sequences ENSMMUP00000039972 ENSMMUP00000039972 9544.ENSMMUP00000039972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]