SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040033 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040033
Domain Number 1 Region: 638-693
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000393
Family cAMP-binding domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040033
Domain Number - Region: 404-457
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0565
Family Voltage-gated potassium channels 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040033   Gene: ENSMMUG00000016075   Transcript: ENSMMUT00000047002
Sequence length 854
Comment pep:known_by_projection chromosome:MMUL_1:2:32250407:32370757:-1 gene:ENSMMUG00000016075 transcript:ENSMMUT00000047002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDTDIVSDINLQKNVSSTWLEYFRSLFFSAPDDLPEIILTLSLISTIGGELLGMSGIF
TLAIVGLLLNSTSFKAGVEALLLEFWNFLSRVAFLMVFTFFGLLIPAHTYLYVKFADIYY
SLNIYFTLIVLRLVTLLLMSPALSRVGHEFSWRWVFTMIWSETKGMPNINMALLLAYSDL
YFGSDKEKSQILFHGVLVCLITLIVNRFVLPTAVTILGLRDATSTKYKSVCCTFQHFQEL
TKSVASVLKFDKDLANADWNMIEKAIILENPYMLNQEETTEQQKVKCPHCNKEIDEILNN
EAMELANRRLLSAQMASYQRQYRNEILSQSAVQVLVGAAGSFGEKKGKCMRLETIKNYSE
SQKTITFTRKLLLNWVYNTRKEKVGPSKYFFFHLCHTIVFTEEFEYVGYLVILMNIFPFV
ISWISRLNAIYRRELKHTNYCFLTLYVLEALLKLIAPKVLQIIDKRVSQQKTFWYGILKG
YVQGEADVMTIIDQITSSKQIKQILLKRVIRNMKHATKELGYLEYDHPEIAVTVKTKEEI
NVMLNMAREILKAFGLKGIIHKIESAQISKLIMAKKKEMLESKSIIRPLTVEEVLYHIQW
LDKNQDHINFIQLERSKPGLGIDQMVESKEKDFLIIDTDYMLSGEIIGEINCLTNEPMKY
SATCETVVETCFIPKTHLYDAFKQCSPLIEHKMWLKIGLAITARKIREHLSYEDWNYKMQ
LKLSNIYIEDIPMTTKTDIYDENVIYVILIHGAVEDCQLRKFYRAPFLIPITCHQIQGIE
DFTKVVIIQTPTNMKAFRWNIRKFIPKHKSSLTPGLMRSTETLEAGIQGETKTNVKEMQE
PAHFLNDLNDKVQL
Download sequence
Identical sequences F6XSY7
ENSMMUP00000040033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]