SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040132 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040132
Domain Number 1 Region: 38-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000524
Family LDL receptor-like module 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040132
Domain Number - Region: 73-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000275
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040132   Gene: ENSMMUG00000032096   Transcript: ENSMMUT00000047106
Sequence length 116
Comment pep:known_by_projection chromosome:MMUL_1:1:56881398:56890782:-1 gene:ENSMMUG00000032096 transcript:ENSMMUT00000047106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPRGENDYAAAGPKAQPEGEGDVPQSLPRFLVAHCGDPASWIYSDQKCDGTNNCGD
CSDELSPVTVCPPCGPGWWHCPSTFFKYCDCIPRRLCRDHIQHCSDWSEEYACPGP
Download sequence
Identical sequences ENSMMUP00000040132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]