SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040202 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040202
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000127
Family EGF-type module 0.006
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040202
Domain Number - Region: 107-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000218
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040202   Gene: ENSMMUG00000026981   Transcript: ENSMMUT00000047176
Sequence length 273
Comment pep:known chromosome:MMUL_1:15:1614365:1648375:-1 gene:ENSMMUG00000026981 transcript:ENSMMUT00000047176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSQEMLLVWLLVLAAGGTEHAYRPGRRVCAVGAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCIQP
GRCRCPAGWQGDTCQSDVDECSAGGAGCPQRCVNTAGSYWCQCWEGHSLSADGTHCVSKG
GPPRVAPNLTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHRLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Download sequence
Identical sequences F7GSK3
ENSMMUP00000040197 ENSMMUP00000040201 ENSMMUP00000040202 9544.ENSMMUP00000040201 NP_001180938.1.72884 XP_014971803.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]