SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040250 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040250
Domain Number 1 Region: 337-484,559-697
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.76e-55
Family Phosphate binding protein-like 0.0000000000739
Further Details:      
 
Domain Number 2 Region: 22-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-51
Family L-arabinose binding protein-like 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040250
Domain Number - Region: 492-554,588-616
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0318
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040250   Gene: ENSMMUG00000001661   Transcript: ENSMMUT00000047223
Sequence length 836
Comment pep:known_by_projection chromosome:MMUL_1:15:1077254:1103471:-1 gene:ENSMMUG00000001661 transcript:ENSMMUT00000047223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCPQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTV
PPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQ
LSYDNKRGPKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSFSARILGMVWAGFAMI
IVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTM
YRHMEKHNYESAAEAIQAVRDNKLHAFIWDSDVLEFEASQKCDLVTTGELFFRSGFGIGM
RKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAG
GIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRA
ITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Download sequence
Identical sequences ENSMMUP00000002232 ENSMMUP00000040250 9544.ENSMMUP00000040250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]