SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040297 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040297
Domain Number 1 Region: 12-168
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.34e-49
Family Mismatch glycosylase 0.00036
Further Details:      
 
Domain Number 2 Region: 216-356
Classification Level Classification E-value
Superfamily Nudix 1.04e-29
Family MutY C-terminal domain-like 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040297   Gene: ENSMMUG00000020079   Transcript: ENSMMUT00000047270
Sequence length 407
Comment pep:known chromosome:MMUL_1:1:48243127:48255479:-1 gene:ENSMMUG00000020079 transcript:ENSMMUT00000047270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWTRTGGHMLKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEELGGHMPR
TAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTLVSQRLW
GLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVQSLCRARQRVEREQLLASRSL
SGNPDVEECALNTGQCQLCLPASEPWDQTLGVVNFPRKASRKPPREESSATCVLEQPGAL
GGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPATRLRHLGEV
VHTFSHIKLTYQVYGLALEGQTPVTTVPAGARWLTQEEFHTAAVSTAMKKVFRVYQGQQP
GTCKGSKRSQVSSPCSRKKPCMGQQVLDNFFRPHISTDASNLNSAAQ
Download sequence
Identical sequences ENSMMUP00000040297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]