SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040301 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040301
Domain Number 1 Region: 89-307
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.88e-67
Family Mismatch glycosylase 0.0000287
Further Details:      
 
Domain Number 2 Region: 355-494
Classification Level Classification E-value
Superfamily Nudix 4.82e-29
Family MutY C-terminal domain-like 0.000000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040301   Gene: ENSMMUG00000020079   Transcript: ENSMMUT00000047274
Sequence length 546
Comment pep:known chromosome:MMUL_1:1:48243078:48254999:-1 gene:ENSMMUG00000020079 transcript:ENSMMUT00000047274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYCSLHQRGPGAIMRKPRAAVGSGHRRQAASQERRQKHAKSNSQAKPSACDGMIPKCPGA
PAGLARQPEEVVLQASVSPYHLFRDIAEVTAFRRSLLSWYDQEKRDLPWRRRAEDEVDPD
RRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGR
RLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLC
RVRAIGADPSSTLVSQRLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVQS
LCRARQRVEREQLLASRSLSGNPDVEECALNTGQCQLCLPASEPWDQTLGVVNFPRKASR
KPPREESSATCVLEQPGALGGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQE
LQRWAGPLPATRLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPAGARWLTQEEFHT
AAVSTAMKKALPLFSGQQPGTCKGSKRSQVSSPCSRKKPCMGQQVLDNFFRPHISTDASN
LNSAAQ
Download sequence
Identical sequences ENSMMUP00000040301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]