SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040346 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040346
Domain Number 1 Region: 134-253
Classification Level Classification E-value
Superfamily Immunoglobulin 4.12e-16
Family C1 set domains (antibody constant domain-like) 0.0057
Further Details:      
 
Domain Number 2 Region: 50-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000645
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040346   Gene: ENSMMUG00000014266   Transcript: ENSMMUT00000047318
Sequence length 326
Comment pep:known chromosome:MMUL_1:11:6606386:6616839:1 gene:ENSMMUG00000014266 transcript:ENSMMUT00000047318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVQVSGGGPSISMVMKTPIDAKNDAFWHPTLNLPLSPQGTVRTAVEFQVTTQTQSLTF
LLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTTGQGQAVRKGATLEPEQLGM
ARDASLTLPSLTIQDEGTYVCQITTSLYRTQQIIQLNIQASPKVRLSLANEALLPTLICD
IAGYYPLDVAVTWTRQELGGSPVQVSGASFSSLRQSVAGTYSISSSLIAEPGSAGATYTC
QVTHISLEEPLGASTQVVPPEQRTALGVIVASSLFLLALLFLGLQRRQAPTRVGLLQAER
WETTSCADAQTSHLQEDRAAHVSQPS
Download sequence
Identical sequences ENSMMUP00000040346 XP_011743865.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]