SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040351 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040351
Domain Number 1 Region: 173-198,256-463
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-58
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 41-137
Classification Level Classification E-value
Superfamily POZ domain 7.06e-26
Family Tetramerization domain of potassium channels 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040351   Gene: ENSMMUG00000020816   Transcript: ENSMMUT00000029285
Sequence length 530
Comment pep:novel chromosome:MMUL_1:11:4923976:4925739:1 gene:ENSMMUG00000020816 transcript:ENSMMUT00000029285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRVDGRGGSNGGGVSRVSSVSRGSQEEEEDEDDSYTFHHGIT
PGEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNII
DLVAIFPYFITLGTELVQQQEQQPASGGGSQNGQQAMSLAILRVIRLVRVFRIFKLSRHS
KGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVT
MTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTH
VTCGQPAPDLKATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV
Download sequence
Identical sequences A0A0D9SCZ0 A0A1D5R5K7 A0A2K5KLX0 A0A2K5UEP3 A0A2K6B6G7
ENSMMUP00000040351 XP_001101937.1.72884 XP_005569924.1.63531 XP_005569925.1.63531 XP_007965495.1.81039 XP_007965496.1.81039 XP_007965497.1.81039 XP_011743830.1.29376 XP_011743831.1.29376 XP_011909636.1.92194 XP_015006366.1.72884 9544.ENSMMUP00000040351 ENSMMUP00000040351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]