SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040429 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040429
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.1e-41
Family ADP-ribosylglycohydrolase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040429   Gene: ENSMMUG00000012030   Transcript: ENSMMUT00000047396
Sequence length 210
Comment pep:known chromosome:MMUL_1:1:38928137:38933103:1 gene:ENSMMUG00000012030 transcript:ENSMMUT00000047396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSKHFLKQ
LLGHMEELEGDAQSVLDARELGMEEHPYSSRLKKIGELLDQASVTREEVVSELGNGIAAF
ESVPTAIYCFLRCMEPDPEIPSAFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQ
VPESWQQSCEGYEETDILAQSLHRVFQKSL
Download sequence
Identical sequences ENSMMUP00000040429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]