SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040438 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040438
Domain Number 1 Region: 1422-1530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 724-838
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1945-2052
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 4 Region: 1768-1887
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-32
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 5 Region: 560-664
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-31
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 6 Region: 180-282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 8-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-28
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 8 Region: 1242-1363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 383-493
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-26
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 10 Region: 2159-2266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2339-2443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1075-1184
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 896-1017
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 14 Region: 1590-1705
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 15 Region: 2928-2999
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2989-3057
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2812-2879
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 18 Region: 2693-2755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 3108-3176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.67e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 320-392
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 21 Region: 2634-2697
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 22 Region: 2101-2169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000111
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 2869-2933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 24 Region: 116-177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 1886-1948
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000391
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2445-2516
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000057
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 27 Region: 2508-2575
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000058
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 28 Region: 2745-2805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 29 Region: 1187-1250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 1535-1602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 31 Region: 3040-3102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 32 Region: 844-904
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 1362-1425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 498-560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 35 Region: 2271-2335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000297
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 1712-1775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 37 Region: 669-737
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 38 Region: 3167-3226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 39 Region: 1017-1079
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 40 Region: 2580-2645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040438   Gene: ENSMMUG00000002741   Transcript: ENSMMUT00000047404
Sequence length 3465
Comment pep:known chromosome:MMUL_1:1:36325804:36899044:-1 gene:ENSMMUG00000002741 transcript:ENSMMUT00000047404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQNCTFQLHGPNGTVESPGFPYGYPNYANCTWTITAEEQHRIQLVFQSFALEEDFDVLSV
FDGPPQPENLRTRLTGFQLPATIVSAATTLSLRLISDYAVSAQGFHATYEVLPSHTCGNP
GRLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGSENSATWDFPLPSCRADDAC
GGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDGYDFLEVTGTE
GSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYQVKKQIELKSRGVKLMPSK
DSSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCNEGYDLQGSKRIT
CMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVWIITALNPAK
AYKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVSTNHQMWLLFQTDG
SGSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFRHGDTLKFECQPAFELVGQKAITCQ
KNNQWSAKKPGCVFSCFFNFTSPSGIVLSPNYPEDYGNHLHCVWLILARPESRIHLAFND
IDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFNIT
FTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCVLKEGSVVWN
SAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKITFDRFKTEVN
YDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQLRYETITL
QSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPNFQWSRALPSCEA
LCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLESGHDYLLITE
NGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFSEYDLEPCEEP
EVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAECGNSV
TGTQGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLKARAFELSEGDVLKVYDGNNNSAR
LLGVFSHSEMMGVTLNSTSSSLWLDFITDAENTSKGFELQFSSFELIKCEDPGTPQFGYK
VHDEGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRTWDRPLPTCVAECGGTVKGEVSGQ
VLSPGYPAPYEHNLNCIWTIEAEAGCTIGLHFLVFDTEEVHDVLRIWDGPVESGVLLKEL
SGPALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVSTATSCNDPGIPQNGSRSGDSWE
AGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCIASCGGDLTGPSGVILSPNYP
EPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGRDSLSPLIGSFYGSQLPG
RIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKLGSSVTY
YCHAGYEVEGASTLSCILGPDGKPVWNNPRPVCTAPCGGQYVGSDGVVLSPNYPQNYTNG
QICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHSRLLSSLSGSHTGESLPLATS
NQVLIKFSAKGLAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFSVGAIVRFECN
SGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPYLNSLNC
VWKIVVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNQL
YLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVSFQCEPGYALQ
GHAHISCMPGTVRRWNYPPPLCIAQCGGTVEEMEGVILSPGFPGNYPSNMDCSWKIALPV
GFGAHIQFLNFSTEPNHDYIEIRNGPYETSRMMGRFSGNELPSSLLSTSHETTVYFHSDH
SQNRPGFKLEYQDLTYSHQISSFLRGFDLSELERTNSTPPVAASYVWELDPGCEAYELQE
CPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLTGHPVLTCQHGTNRNWDHPLPKCEVPC
GGNITSSNGTVYSPGFPSPYSSSQDCVWLITVPIGHGVRLNLSLLQTEPSGDFITIWDGP
QQTAPRLGVFTRSMAKKTVHSSSNQVLLKFHRDAATGGIFAIAFSAYPLTKCPPPTILPN
AEVVTENEEFNIGDIVRYRCLPGFTLVGNEILTCKLGTYLQFEGPPPICEVHCPTNELLT
DSTGVILSQSYPGSYPQFQTCSWLVRVEPDYNISLTVEYFLSEKQYDEFEIFDGPSGQSP
LLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKIRYSAPYCSLPRAPLHGFILGQ
TSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGLV
FGKEYTVGTKAVYSCSEGYHLQAGAEAAAECLDTGLWSNHNVPPQCIPVTCPDVSSISVE
HGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQANGKWSLGDSTPTCRIISCGELP
VPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCLAGHCGTPEPI
VNGHINGENYSYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVLVSCGHPSSPPH
SQMSGDSYTVGAVVRYSCTGKRTLVGNSTRMCGLDGHWTGSLPHCSGTSMGVCGDPGIPA
HGIRLGDSFDPGSVMRFSCEAGHVLRGSSERTCQANGSWSGSQPECGVISCGNPGTPSNA
RVVFSDGLVFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECLVINCGDPGIPANGL
RLGNDFRYNKTVTYQCVPGYMMESHRVSVLSCTKDRTWNGTKPVCKALMCKPPPLIPNGK
VVGSDFMWGSSVAYACLEGYQLSLPAVLTCEGNGSWTGELPQCFPVFCGDPGVPPRGRRE
DRGFSYRSSVSFSCHPPLVLVGSPRRFCQSDGTWSGTQPSCIDPTLTTCADPGVPQFGIQ
NNSQGYQVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGTPPDCVPHHCRQPETPTHANVG
ALDLPSMGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGKPPICLEVRPSGRPINTAREPP
LTQALIPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQVANSKVNATMIDHSGVELHLAG
TYKKEDFHLLLQVYQITGPVEIFVNQFRDDHWALDGHVSSESSGGTFIYQGSVKGQGFGQ
FGFQRLDLRLLESDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPF
NGYAGHENTNVRATFENPMYDRNIQPTDIMASEAEFTVSTVCTAV
Download sequence
Identical sequences ENSMMUP00000040438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]