SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040489 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040489
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 7.52e-26
Family Ribosomal L11/L12e N-terminal domain 0.0000155
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.45e-17
Family Ribosomal protein L11, C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040489   Gene: ENSMMUG00000032209   Transcript: ENSMMUT00000047455
Sequence length 165
Comment pep:novel chromosome:MMUL_1:1:29628248:29629154:1 gene:ENSMMUG00000032209 transcript:ENSMMUT00000047455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLKFGPNEIKVTYLRCTRGEVGATSMLAPKISPLGLSPKKVGDDIAKAKGDWKGLRITV
KLTSQNRQAQIEVVPSASALIIKALKEPPRDRKKRKNIKHRGNITFDEIFNIAQQMQHQS
LARDLSATIKGISGTAHSAGCNVDGCHPHDIIDDINSGAVESLAT
Download sequence
Identical sequences ENSMMUP00000040489 ENSMMUP00000040489 9544.ENSMMUP00000040489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]