SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040508 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040508
Domain Number 1 Region: 91-314
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-24
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040508   Gene: ENSMMUG00000032213   Transcript: ENSMMUT00000047475
Sequence length 472
Comment pep:known chromosome:MMUL_1:1:28812292:28825044:1 gene:ENSMMUG00000032213 transcript:ENSMMUT00000047475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDNEKAWWQQWTSYTGLVVGGGTQEDRMGFGRGVAALRGRPSPLQSAIHESYGRPEEQV
LINRRDIMNKADTWDMQEYITRMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQK
HYEFFSTIDDIVLTILMCEVLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPS
INYTLRALRLVHVCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLFGAFV
PKHFRNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGAIYFTIFITIGAFIGIN
LFVIVVTTNLEQMMKAEEQGQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSRFPQEP
LVGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRDELNMIVEEVRAIRFNQEQEAEVMQ
RQSSTSGSLETTSSKDVRQMSQHRDLLSALVNMEKVHDSSSQILLKKRKNSH
Download sequence
Identical sequences F7FZX1 G8F384
ENSMMUP00000040508 9544.ENSMMUP00000040508 XP_001108634.1.72884 XP_005544417.1.63531 ENSMMUP00000040508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]