SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040540 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040540
Domain Number 1 Region: 386-471
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 3553-3641
Classification Level Classification E-value
Superfamily Immunoglobulin 8.77e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 1936-2024
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 3279-3368
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 3192-3284
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-19
Family I set domains 0.0077
Further Details:      
 
Domain Number 6 Region: 2031-2117
Classification Level Classification E-value
Superfamily Immunoglobulin 8.31e-19
Family I set domains 0.037
Further Details:      
 
Domain Number 7 Region: 1657-1752
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 3476-3559
Classification Level Classification E-value
Superfamily Immunoglobulin 5.28e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 9 Region: 1755-1840
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-16
Family I set domains 0.000028
Further Details:      
 
Domain Number 10 Region: 3003-3098
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 11 Region: 3089-3183
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-16
Family I set domains 0.035
Further Details:      
 
Domain Number 12 Region: 2416-2503
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-16
Family I set domains 0.05
Further Details:      
 
Domain Number 13 Region: 2609-2697
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 14 Region: 2518-2602
Classification Level Classification E-value
Superfamily Immunoglobulin 7.25e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 15 Region: 2225-2308
Classification Level Classification E-value
Superfamily Immunoglobulin 7.48e-16
Family I set domains 0.048
Further Details:      
 
Domain Number 16 Region: 2711-2797
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000223
Family I set domains 0.054
Further Details:      
 
Domain Number 17 Region: 2905-2990
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000376
Family I set domains 0.072
Further Details:      
 
Domain Number 18 Region: 2135-2218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000388
Family I set domains 0.06
Further Details:      
 
Domain Number 19 Region: 1846-1933
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000675
Family I set domains 0.046
Further Details:      
 
Domain Number 20 Region: 3381-3472
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000923
Family I set domains 0.021
Further Details:      
 
Domain Number 21 Region: 2807-2893
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000102
Family I set domains 0.035
Further Details:      
 
Domain Number 22 Region: 2324-2410
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000764
Family V set domains (antibody variable domain-like) 0.094
Further Details:      
 
Domain Number 23 Region: 303-341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 24 Region: 1544-1596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 25 Region: 348-391
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 26 Region: 745-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 27 Region: 263-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 1140-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 29 Region: 805-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 30 Region: 175-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 1603-1651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 32 Region: 1200-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040540
Domain Number - Region: 1256-1303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number - Region: 868-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 1103-1142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family Laminin-type module 0.092
Further Details:      
 
Domain Number - Region: 1509-1546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040540   Gene: ENSMMUG00000014828   Transcript: ENSMMUT00000047505
Sequence length 3680
Comment pep:known chromosome:MMUL_1:1:24449355:24514510:-1 gene:ENSMMUG00000014828 transcript:ENSMMUT00000047505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVTHGLSAYDGLSLPEDTETVTASQMRWTHSYLSDDEDMLADSTSGDDLGSGDLGSGDF
QMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKE
LDGWVFVELDVGSEGNADGAQIQEVLLRVISSGSMASYITSPRGFQFRRLGTVPQFPRAC
TEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEELVLGISPTVSLLVETTPLPLRPE
TAIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRSGHCIPGDYLCDGQEDCEDGSDELDC
GPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTN
VCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQESIQASRGQTVTFTCVAIGVPTPIIN
WRLNWGHIPSHPRVTVTSEGGRGTLTIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELV
PQRGPCPDGHFYLEHSASCLPCFCFGITSVCQSSRRFRDQIRLRFDQPDDFKGVNVVMPA
QPSMPPLSSTQLQIDPALHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVR
YELARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQR
AELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSG
LSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGF
FGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYE
GNPIQPGGKCRPVNQEIVRCDERGSVGTSGEACRCKNNVVGRLCNECADGSFHLSTQNPD
GCLKCFCMGVSRQCTSSSWSRAQVHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFS
SFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIIL
EHHPAQEPSPGQPSTFTVPFREQAWQRPDGQPATREHLLMALAGIDTLLVRASYAQQPTE
SRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERC
SCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQ
AAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCRRDGQVPGPIGCNCDP
QGSVSSQCDTAGQCQCKAQVEGLTCSHCRPHHFHLNASNPEGCLPCFCMGITQQCASSAY
TRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAHLGHESFYWQL
PETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGTERRSY
EIVLREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPS
SGPRALEVEECRCPPGYIGLSCQDCAAGYTRTGSGLYLGHCELCECNGHSDLCHPETGAC
SQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCT
ACEPGYTGQYCEQCAPGYVGNPSVQGGRCLPETNQAPLVVEVHPARSVVPQGGSHSLRCQ
VSGSPPHYFYWSREDGRPVPSSTQQRHQGSELHFPSVQPSDAGVYICTCRNLHHANTSRA
ELLVTEAPSKPITVTVEEQRSQSVRPGTDVTFICTAKSKSPAYTLVWTRLHNGKLPTRAM
DFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQASGTSSAPVVSIHPPQLTVQP
GQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIRGGILRLPAVEPTDQAQYLCRAHSSA
GQQVARAVLHVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPSATITWRKEGGSLPPQ
ARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQVVVLSASDASPPPVKIESSS
PSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGSRLRLPQVSPADSGEYVCRV
ENGSGPKEASITVSVLHGTHSGPSYTPAPGSTQPIRIEPSSSHVAEGQTLDLNCVVPGQA
HAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCRVVGTSGPLQASVLVTIEASV
IPGRDPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIF
QASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGSTQPVRVEPSSSQVAEGQTLD
LNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQVSPADSGEYVCRVAGSSVPLEAS
VLVTIEPAGSVPALGVTPTVRIESSSSHVAEGQTLDLNCLVAGQAHAQVTWHKRGGSLPA
RHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTIQQRLSGSHSQGVAYPVRIE
SSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYV
CHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVARQPQA
IITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANNNIDALEASIVISVSPRAGS
PSAPGSSMPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPSHHQAHGSRLR
LHQVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHVPAPGGAPPIRIETSSSRVA
EGQTLDLKCVVPGQAHAQVTWHKRGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSS
GTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWY
KRGGSLPARHQTHGSQLRLHQVSPADSGEYVCRAAGGPGPEQEASFTVTVPPSEGSSYRL
RSPVISIDPPSSTVQQGQDASFKCLIHDGAVPISLEWKTRNQELEDNVHISPNGSIITIV
GTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGE
PRSSARWTRISSAPAKLEQRTYGLMDSRAVLQISSAKPSDAGTYVCLAQNALGTAQKQVE
VIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPTPTIHWSKLRSPLPWQHRLE
GDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQ
CLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQ
LLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQ
LPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGQAQASAQLVVQALPSVLINIRTSVQT
VVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATN
AAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDS
RLENNMLTLPSVQPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTI
KDAYRKFEIKITFRPDSADG
Download sequence
Identical sequences ENSMMUP00000040540 9544.ENSMMUP00000040540 ENSMMUP00000002111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]