SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040559 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040559
Domain Number 1 Region: 28-193
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000314
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040559   Gene: ENSMMUG00000006688   Transcript: ENSMMUT00000047527
Sequence length 971
Comment pep:known chromosome:MMUL_1:1:21875654:21905660:-1 gene:ENSMMUG00000006688 transcript:ENSMMUT00000047527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEWASRFWLWAVLLIPVAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEIYAITVSSGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESVRY
IAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKF
NVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALETEWELRQIPLQ
SLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALV
SFATTGEKTVAAVMACRNEVQKPSNSEDGSMGSFPEKSSSKDSLACFNQTYTINLYLVET
GRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVL
WSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHL
WKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLP
NVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSSLYVFNPIFGKWSQVAPPVLKRP
ILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLC
GYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLA
VVTESTDTHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARR
NEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLL
IGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGI
YTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRL
AQVKLLNRAWR
Download sequence
Identical sequences A0A2K5X734 A0A2K6D3G6 F7FSE2
ENSMMUP00000040559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]