SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040564 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040564
Domain Number 1 Region: 106-144,258-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000618
Family I set domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040564
Domain Number - Region: 35-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00157
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040564   Gene: ENSMMUG00000023517   Transcript: ENSMMUT00000047532
Sequence length 310
Comment pep:known_by_projection chromosome:MMUL_1:1:20916302:21018977:1 gene:ENSMMUG00000023517 transcript:ENSMMUT00000047532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APNPCSHFNCGSQVTDGGTIKQKIFTFDAMFSTNYSHMENYRKREDLVYQSTVRLPEVRI
SDNGPYECHVGIYDRATREKVVLASGNIFLNVMAPPTSIEVVAADTPAPFSRYQAQNFTL
VCIVSGGKPAPMVYFKRDGEPIDAVPLSEPPAASSGPLQDSRPFRSLLHRDLDDTKMQKS
LSLLDAENRGGRPYTERPSHGLTPDPNILLQPTTENIPETVVSREFPRWVHSAEPTYFLR
HSRTPSSDGTVEVRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVAPKGPKIVM
TPSRARVGDT
Download sequence
Identical sequences ENSMMUP00000040564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]