SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040788 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040788
Domain Number 1 Region: 213-459
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-86
Family Eukaryotic proteases 0.00000000863
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.16e-25
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040788   Gene: ENSMMUG00000020064   Transcript: ENSMMUT00000047761
Sequence length 461
Comment pep:known chromosome:MMUL_1:X:137713620:137745757:1 gene:ENSMMUG00000020064 transcript:ENSMMUT00000047761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCNFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCKQFCKNTADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSTLTRAETVFPDVEYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIINEKWVVTAAHCVETDAKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNATINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
NKGRSASVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences F7GHR4
9544.ENSMMUP00000040788 ENSMMUP00000040788 ENSMMUP00000026395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]