SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040886 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040886
Domain Number 1 Region: 345-375
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000994
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040886   Gene: ENSMMUG00000007185   Transcript: ENSMMUT00000047857
Sequence length 376
Comment pep:known_by_projection chromosome:MMUL_1:X:106687844:106689341:-1 gene:ENSMMUG00000007185 transcript:ENSMMUT00000047857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRPEDPSSGFRHSNVVAFINEKMARHTKGPEFYLENISLSWEEVEDKLWAILEDSEVP
SEVKEACTWGSLALGVRFAHRQGQLQNRRVQWLQGFAKLHRLAAMVLASNLTEFKEQQEM
ECNKATFQLRITQTSLAEAQRERDMLRWKLLHAELASPQRQGQATVFPGLATARGDWTEG
AGEQEKEAVAAAGAAEGEGEERFAEAGPAPEEALQGLGGGFRHPLGAVEQANYTFGGQRE
QDLRSAQTALSYFSGPGSTASLEPLPVQLPTSFTYSYPCPLSAFSAIPTIPPSPAKVTAP
VPTQMPSNWGASDASLWSDVGAQGIDPQEPPRDRRDSEPHQQRRPPVYRRPGDWDCPWCK
TVNFSRRENCFLCGRR
Download sequence
Identical sequences 9544.ENSMMUP00000040886 ENSMMUP00000040886 ENSMMUP00000009418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]