SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040963 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040963
Domain Number 1 Region: 5-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.41e-169
Family Phosphoglycerate kinase 0.0000000000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040963   Gene: ENSMMUG00000012874   Transcript: ENSMMUT00000047930
Sequence length 417
Comment pep:known chromosome:MMUL_1:X:76815714:76838584:1 gene:ENSMMUG00000012874 transcript:ENSMMUT00000047930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLE
NLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAQGTKALMDEVV
KATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Download sequence
Identical sequences A0A096NZ57 A0A2J8USZ0 G7Q337 I0FSL5 Q5NVB5 Q60HD8
ENSPANP00000018375 9544.ENSMMUP00000040963 9600.ENSPPYP00000022944 ENSPPYP00000022944 ENSMMUP00000040963 ENSMMUP00000016910 NP_001182587.1.72884 NP_001274599.1.63531 XP_011823845.1.47321 ENSPPYP00000022944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]